PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m010908
Common NameLOC8271430, RCOM_1676030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 194aa    MW: 22276 Da    PI: 9.7012
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m010908genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.7e-33115173159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  30190.m010908 115 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYQGCNVKKQVQRLTKDEGVVITTYEGAHTHP 173
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.9E-35100173IPR003657WRKY domain
SuperFamilySSF1182906.93E-30107174IPR003657WRKY domain
PROSITE profilePS5081130.033110175IPR003657WRKY domain
SMARTSM007741.4E-39115174IPR003657WRKY domain
PfamPF031063.1E-27116173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MEKFQMLFPF SSTTEPSSAT YPISSNMINS HALSNFEGIN DSYGFLGLKI ENDHQVASSV  60
SRTEVFNNND LKSTQSHAHI AIGSESETKS SKKKGEKKIR KPRYAFQTRS QVDILDDGYR  120
WRKYGQKAVK NNKFPRSYYR CTYQGCNVKK QVQRLTKDEG VVITTYEGAH THPIEKPTDN  180
FEHILSQMQI YTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-28105174776Probable WRKY transcription factor 4
2lex_A6e-28105174776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8276275e-93KT827627.1 Manihot esculenta WRKY transcription factor 52 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509495.11e-146PREDICTED: probable WRKY transcription factor 75
TrEMBLB9RBG11e-146B9RBG1_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0001s33560.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-59WRKY DNA-binding protein 75